PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02865.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 264aa    MW: 29222.7 Da    PI: 9.1528
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02865.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.9e-1896150256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  Zpz_sc02865.1.g00020.1.am.mk  96 RKKLRLSKEQSAFLEDSFKEHSTLTPNQKNDLARRLNLRPRQVEVWFQNRRARTK 150
                                   678899***********************************************98 PP

2HD-ZIP_I/II115.82.5e-3796185191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LE+sF+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+  e+Lkr++ +l++en+rL+
  Zpz_sc02865.1.g00020.1.am.mk  96 RKKLRLSKEQSAFLEDSFKEHSTLTPNQKNDLARRLNLRPRQVEVWFQNRRARTKLKQTEVHREYLKRWCATLTQENRRLQ 176
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   +ev+eLr +l
  Zpz_sc02865.1.g00020.1.am.mk 177 REVAELR-AL 185
                                   ******9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-1889153IPR009057Homeodomain-like
PROSITE profilePS5007116.7392152IPR001356Homeobox domain
SMARTSM003891.9E-1594156IPR001356Homeobox domain
PfamPF000462.5E-1596150IPR001356Homeobox domain
CDDcd000867.00E-1696153No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1796150IPR009057Homeodomain-like
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PfamPF021831.1E-6152185IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.1E-19152195IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MELKLRLGDS SAPAKATFAT VPTSAHAGSR EDHELVLELG TGTAKRAEQD NQKTHLQLEE  60
DDEANSRSES PVEVPLHQAA DQEGAEDEEN GVGGVRKKLR LSKEQSAFLE DSFKEHSTLT  120
PNQKNDLARR LNLRPRQVEV WFQNRRARTK LKQTEVHREY LKRWCATLTQ ENRRLQREVA  180
ELRALRTTYP IYYGQPAAGF SSGATRGCPS CGNMAAPYPV ITALSSSVVA APPPSVSALF  240
ASSRPFLGPF TVHPVLRRHP SATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.11e-108PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6747e-70HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLK3YZM61e-97K3YZM6_SETIT; Uncharacterized protein
STRINGSi019736m3e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-52homeobox from Arabidopsis thaliana